PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016491351.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 748aa    MW: 83650.7 Da    PI: 4.5336
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016491351.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding409.3e-13596637346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rW+++E el+++av+q+G++  ++I + ++ gRt+ q+k+++ k
   XP_016491351.1 596 RWSKQETELFYEAVQQFGTD-LSLIQQLFP-GRTRRQLKLKYKK 637
                      9*******************.*********.***********87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF159631.1E-28587671No hitNo description
PROSITE profilePS5129311.203592640IPR017884SANT domain
SMARTSM007173.1E-10593641IPR001005SANT/Myb domain
SuperFamilySSF466898.97E-11595644IPR009057Homeodomain-like
CDDcd001673.78E-8596637No hitNo description
Gene3DG3DSA:1.10.10.606.7E-8596637IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 748 aa     Download sequence    Send to blast
MCIWIWFLKN LVLMWNTKQR SYSLLINLSM DLLDDILADG ASKTVKAGGK FQPKAKPRPV  60
KKGPAVASST VSLTSKPTGD TVATDSFEAL KKDGKNSQNY YEQSSVLAEP SLEHPLAAET  120
LCPSVGSYLD TSTVVPDNSE DSKTCLEKSE GEYADIYIGL DSFDDLLPTS SAIENSSPAT  180
DPSAVHVDGA EKGQDQLSIP VSSVDDSAPS TSNLQPDEVA GCQDPLTCQG SVVPEMDSYP  240
SLEADILGVT TTSGQSTRRF QPKSKLQVYR ERYDTSIPDS DAVESVSCQP NSHSVHSEMD  300
FVDRGKEHGF PADDVLDFSA RGFDNNIITE STHEFPVHEE YVIEASHSDV RIPAELHEST  360
SQMPEEPVHQ RPKTKKQKLP ASDLSAITEE NGAGRSLRSR RKSVNANRLV DESEVVADDG  420
EYVPEQPNDS VTNGNNEDLL VENESQGKKV QKKSKRTVAE DGKQVRKSKK TTEASDQAAN  480
KKPKKFSHST RQKRRQVNKA LLEAPEYEID YQKVPIKDLI ILGEHRERLA KKDAAASQIP  540
TTDQSTGASV SNYNEDETYP SDDGAEDNDH QIGSRAQDSS AYFNYQTYMD KTPSTRWSKQ  600
ETELFYEAVQ QFGTDLSLIQ QLFPGRTRRQ LKLKYKKEER QHPFRLHDAL TNRSKDHSHF  660
ERVIERLKQI EAEELQKADK DESIDLTGEQ EVEEGTQEIN EEEANSENVE KKEVEAVEQQ  720
DVPEMESPIE DYDSEDDSWR WSQYKSEV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016491351.10.0PREDICTED: uncharacterized protein LOC107811026 isoform X3
TrEMBLM1BI380.0M1BI38_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000457280.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39160.16e-50MYB_related family protein